H00195814-B01

SDR16C5 antibody from Abnova Corporation
EPHD-2, RDH-E2, RDHE2

Antibody data

Product number
H00195814-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00195814-B01, RRID:AB_1115195
Product name
RDHE2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00195814-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RDHE2 protein.
Antigen sequence
MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPR
KNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW
DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGV
YRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE
LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCI
SSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV
QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPIL
EPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF
LPLKTGLLIADYLGILHAMDGFVDQKKKL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -