HPA001634

RBM22 antibody from Atlas Antibodies
Cwc2, FLJ10290, fSAP47, ZC3H16
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA001634
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001634, RRID:AB_1079746
Product name
Anti-RBM22
Provider product page
Atlas Antibodies - HPA001634
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYG
KECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKL
KNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDV
NKEYYTQNMEREISNSDGTRPVGMLGKATSTSDML
LKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -