HPA001634

RBM22 antibody from Atlas Antibodies
Cwc2, FLJ10290, fSAP47, ZC3H16
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA001634
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001634, RRID:AB_611738
Product name
Anti-RBM22
Provider product page
Atlas Antibodies - HPA001634
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYG
KECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKL
KNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDV
NKEYYTQNMEREISNSDGTRPVGMLGKATSTSDML
LKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -