HPA001634

RBM22 antibody from Sigma-Aldrich
Cwc2, FLJ10290, fSAP47, ZC3H16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001634, RRID:AB_1079746
Product name
Anti-RBM22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001634
Antibody type
Polyclonal
Antigen
Pre-mRNA-splicing factor RBM22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYG
KECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKL
KNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDV
NKEYYTQNMEREISNSDGTRPVGMLGKATSTSDML
LKL
Storage
-20C
Provider Type Product Number
- No reagents -