HPA020653

NSUN7 antibody from Sigma-Aldrich
FLJ14001
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020653, RRID:AB_1848710
Product name
Anti-NSUN7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020653
Antibody type
Polyclonal
Antigen
Putative methyltransferase NSUN7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEVQEVENLLNSFKIKLAAALARCRIKHDALSIYH
ILPETVRKQELRASTLPLYAWINTCKISPEEVYNN
LKRRGYNKVKSVLHIDDKVFAVDQHCYDVLIFPSH
LKNDLINIDLFKDYKLIFQDKSRSLA
Storage
-20C
Provider Type Product Number
- No reagents -