HPA002043

PLEKHA1 antibody from Sigma-Aldrich
TAPP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002043
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002043, RRID:AB_1079632
Product name
Anti-PLEKHA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002043
Antibody type
Polyclonal
Antigen
Pleckstrin homology domain-containing family A member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SASSEHPPGPSESKHAFRPTNAATATSHSTASRSN
SLVSTFTMEKRGFYESLAKVKPGNFKVQTVSPREP
ASKVTEQALLRPQSKNGPQEKDCDLVDLDDAS
Storage
-20C
Provider Type Product Number
- No reagents -