HPA018418

IFT27 antibody from MilliporeSigma / Merck KGaA
BBS19, FAP156, RABL4, RAYL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018418
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-RABL4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018418
Antibody type
Polyclonal
Antigen
Putative GTP-binding protein RAY-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTD
LAGRRAVDSAEARAWALGQGLECFETSVKEMENFE
APFHCLAKQFHQLYREKVEV
Storage
-20C