HPA020961

HINT2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020961
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020961, RRID:AB_1850715
Product name
Anti-HINT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020961
Antibody type
Polyclonal
Antigen
Histidine triad nucleotide-binding protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGY
RLVINDGKLGAQSVYHLHIHVLGGRQLQWP
Storage
-20C
Provider Type Product Number
- No reagents -