Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005483 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005483, RRID:AB_1079260
- Product name
- Anti-SH2B3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYT
FVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRG
LESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASP
GGLLDPACQKTDHFLSCYPWFH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CXM: a new tool for mapping breast cancer risk in the tumor microenvironment.
Flister MJ, Endres BT, Rudemiller N, Sarkis AB, Santarriaga S, Roy I, Lemke A, Geurts AM, Moreno C, Ran S, Tsaih SW, De Pons J, Carlson DF, Tan W, Fahrenkrug SC, Lazarova Z, Lazar J, North PE, LaViolette PS, Dwinell MB, Shull JD, Jacob HJ
Cancer research 2014 Nov 15;74(22):6419-29
Cancer research 2014 Nov 15;74(22):6419-29
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong nuclear membrane positivity in reaction center cells and lymphoid cells outside reaction center.
- Sample type
- HUMAN