HPA005483

SH2B3 antibody from Sigma-Aldrich
IDDM20, LNK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005483
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005483, RRID:AB_1079260
Product name
Anti-SH2B3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005483
Antibody type
Polyclonal
Antigen
SH2B adapter protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYT
FVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRG
LESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASP
GGLLDPACQKTDHFLSCYPWFH
Storage
-20C
Provider Type Product Number
- No reagents -