Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184338 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cold Shock Domain Protein A (CSDA) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGY
RRPYN YRRRPRPPNA- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references High-molecular-mass APOBEC3G complexes restrict Alu retrotransposition.
Somatic mutation and SNP in the promoter of dbpA and human hepatocarcinogenesis.
Chiu YL, Witkowska HE, Hall SC, Santiago M, Soros VB, Esnault C, Heidmann T, Greene WC
Proceedings of the National Academy of Sciences of the United States of America 2006 Oct 17;103(42):15588-93
Proceedings of the National Academy of Sciences of the United States of America 2006 Oct 17;103(42):15588-93
Somatic mutation and SNP in the promoter of dbpA and human hepatocarcinogenesis.
Hayashi J, Kajino K, Umeda T, Takano S, Arakawa Y, Kudo M, Hino O
International journal of oncology 2002 Oct;21(4):847-50
International journal of oncology 2002 Oct;21(4):847-50
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: CSDA Sample Tissue: 239T lysates Antibody Dilution: 1.0 μg/mL YBX3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells