Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004223-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004223-M03, RRID:AB_518707
- Product name
- MEOX2 monoclonal antibody (M03), clone 6A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MEOX2.
- Antigen sequence
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDH
MSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHH
HHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARH
SLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTG
AACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQE
GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNY
LTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVK
GGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQ
QTGDSIANEDSHDSDHSSEHAHL- Isotype
- IgG
- Antibody clone number
- 6A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-130a mediates proliferation of vascular smooth muscle cells in hypertension.
Wu WH, Hu CP, Chen XP, Zhang WF, Li XW, Xiong XM, Li YJ
American journal of hypertension 2011 Oct;24(10):1087-93
American journal of hypertension 2011 Oct;24(10):1087-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MEOX2 expression in transfected 293T cell line by MEOX2 monoclonal antibody (M03), clone 6A5.Lane 1: MEOX2 transfected lysate(33 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MEOX2 monoclonal antibody (M03), clone 6A5. Western Blot analysis of MEOX2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MEOX2 monoclonal antibody (M03), clone 6A5. Western Blot analysis of MEOX2 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MEOX2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MEOX2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MEOX2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol