Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182641 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mesenchyme Homeobox 2 (MEOX2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the N terminal of human MEOX2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSC
IIAGY PNEEGMFASQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France.
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Lazrek M, Goffard A, Schanen C, Karquel C, Bocket L, Lion G, Devaux M, Hedouin V, Gosset D, Hober D
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Kimura K, Wakamatsu A, Suzuki Y, Ota T, Nishikawa T, Yamashita R, Yamamoto J, Sekine M, Tsuritani K, Wakaguri H, Ishii S, Sugiyama T, Saito K, Isono Y, Irie R, Kushida N, Yoneyama T, Otsuka R, Kanda K, Yokoi T, Kondo H, Wagatsuma M, Murakawa K, Ishida S, Ishibashi T, Takahashi-Fujii A, Tanase T, Nagai K, Kikuchi H, Nakai K, Isogai T, Sugano S
Genome research 2006 Jan;16(1):55-65
Genome research 2006 Jan;16(1):55-65
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting