HPA020595

ACADVL antibody from Atlas Antibodies
ACAD6, LCACD, VLCAD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020595
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020595, RRID:AB_1844479
Product name
Anti-ACADVL
Provider product page
Atlas Antibodies - HPA020595
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGM
AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLI
QEKLARMVMLQYVTESMAYMVSANMDQGATDFQI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -