Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000037-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000037-M01, RRID:AB_509100
- Product name
- ACADVL monoclonal antibody (M01), clone 5D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACADVL.
- Antigen sequence
AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLI
QEKLARMVMLQYVTESMAYMVSANMDQGATDFQIE
AAISKIFGSEAAWKVTDECI- Isotype
- IgG
- Antibody clone number
- 5D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ACAD9, a complex I assembly factor with a moonlighting function in fatty acid oxidation deficiencies.
Mild mitochondrial uncoupling does not affect mitochondrial biogenesis but downregulates pyruvate carboxylase in adipocytes: role for triglyceride content reduction.
Nouws J, Te Brinke H, Nijtmans LG, Houten SM
Human molecular genetics 2014 Mar 1;23(5):1311-9
Human molecular genetics 2014 Mar 1;23(5):1311-9
Mild mitochondrial uncoupling does not affect mitochondrial biogenesis but downregulates pyruvate carboxylase in adipocytes: role for triglyceride content reduction.
De Pauw A, Demine S, Tejerina S, Dieu M, Delaive E, Kel A, Renard P, Raes M, Arnould T
American journal of physiology. Endocrinology and metabolism 2012 May 15;302(9):E1123-41
American journal of physiology. Endocrinology and metabolism 2012 May 15;302(9):E1123-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACADVL monoclonal antibody (M01), clone 5D3 Western Blot analysis of ACADVL expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ACADVL is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol