HPA020595

ACADVL antibody from Sigma-Aldrich
ACAD6, LCACD, VLCAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020595
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020595, RRID:AB_1844479
Product name
Anti-ACADVL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020595
Antibody type
Polyclonal
Antigen
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGM
AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLI
QEKLARMVMLQYVTESMAYMVSANMDQGATDFQI
Storage
-20C
Provider Type Product Number
- No reagents -