HPA003607

SERPINA4 antibody from Sigma-Aldrich
KAL, kallistatin, KLST, KST, PI4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003607
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003607, RRID:AB_1079914
Product name
Anti-SERPINA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003607
Antibody type
Polyclonal
Antigen
Kallistatin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSA
LFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVG
TIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNY
IYFKALWEKPFISSRTTPKDFYVDENTTVRVPMML
QDQE
Storage
-20C
Provider Type Product Number
- No reagents -