HPA004105

WASF1 antibody from Sigma-Aldrich
KIAA0269, SCAR1, WAVE, WAVE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004105, RRID:AB_1080583
Product name
Anti-WASF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004105
Antibody type
Polyclonal
Antigen
Wiskott-Aldrich syndrome protein family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVA
NGPASHFETRPQTYVDHMDGSYSLSALPFSQMSEL
LTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCIS
SATGLIENRPQSPATGRTPVFVSPTP
Storage
-20C
Provider Type Product Number
- No reagents -