HPA023067

NSMAF antibody from Sigma-Aldrich
FAN, GRAMD5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023067
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023067, RRID:AB_1854653
Product name
Anti-NSMAF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023067
Antibody type
Polyclonal
Antigen
Protein FAN recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQIT
LQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIYLK
FYEPQDRDDLYFYIATYLEHHVAEHTAESY
Storage
-20C
Provider Type Product Number
- No reagents -