H00002628-M08A

GATM antibody from Abnova Corporation
AGAT
No application information provided.

Antibody data

Product number
H00002628-M08A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002628-M08A, RRID:AB_1575102
Product name
GATM monoclonal antibody (M08A), clone 2H7
Provider product page
Abnova Corporation - H00002628-M08A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GATM.
Antigen sequence
MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRT
FQSTQAATASSRNSCAADDKATEPLPKDCPVSSYN
EWDPLEEVIVGRAENACVPPFTIEVKANTY
Isotype
IgM
Antibody clone number
2H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -