HPA002354

HMGXB3 antibody from Sigma-Aldrich
HMGX3, KIAA0194, SMF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002354
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002354, RRID:AB_1080046
Product name
Anti-HMGXB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002354
Antibody type
Polyclonal
Antigen
protein SMF recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVQEQTEKTLTSEELSQLQELLCNGYWAFECLTVR
DYNDMICGICGVAPKVEMAQRSEENVLALKSVEFT
WPEFLGSNEVNVEDFWATMETEVIEQVAFPASIPI
TKFDASVIAPFFPPLMRGAVVVNTEKDK
Storage
-20C
Provider Type Product Number
- No reagents -