HPA022813

BZW2 antibody from Atlas Antibodies
HSPC028, MST017, MSTP017
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022813
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022813, RRID:AB_1845511
Product name
Anti-BZW2
Provider product page
Atlas Antibodies - HPA022813
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLKELSDFLRVQQSLGTRKELQKELQERLSQECPI
KEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEW
NKKEELV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -