HPA022813

BZW2 antibody from Sigma-Aldrich
HSPC028, MST017, MSTP017
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022813, RRID:AB_1845511
Product name
Anti-BZW2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022813
Antibody type
Polyclonal
Antigen
Basic leucine zipper and W2 domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLKELSDFLRVQQSLGTRKELQKELQERLSQECPI
KEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEW
NKKEELV
Storage
-20C
Provider Type Product Number
- No reagents -