Antibody data

Product number
H00000013-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000013-M01, RRID:AB_605884
Product name
AADAC monoclonal antibody (M01), clone 2E8
Provider product page
Abnova Corporation - H00000013-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AADAC.
Antigen sequence
QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQEN
SNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHV
PVESSHLFKFINWSSLLPERFIKGHVYNNP
Isotype
IgG
Antibody clone number
2E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -