Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000013-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000013-M01, RRID:AB_605884
- Product name
- AADAC monoclonal antibody (M01), clone 2E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AADAC.
- Antigen sequence
QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQEN
SNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHV
PVESSHLFKFINWSSLLPERFIKGHVYNNP- Isotype
- IgG
- Antibody clone number
- 2E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references N-Glycosylation during translation is essential for human arylacetamide deacetylase enzyme activity.
Metabolic activation by human arylacetamide deacetylase, CYP2E1, and CYP1A2 causes phenacetin-induced methemoglobinemia.
A novel polymorphic allele of human arylacetamide deacetylase leads to decreased enzyme activity.
Species differences in tissue distribution and enzyme activities of arylacetamide deacetylase in human, rat, and mouse.
Human arylacetamide deacetylase is a principal enzyme in flutamide hydrolysis.
Muta K, Fukami T, Nakajima M, Yokoi T
Biochemical pharmacology 2014 Jan 15;87(2):352-9
Biochemical pharmacology 2014 Jan 15;87(2):352-9
Metabolic activation by human arylacetamide deacetylase, CYP2E1, and CYP1A2 causes phenacetin-induced methemoglobinemia.
Kobayashi Y, Fukami T, Higuchi R, Nakajima M, Yokoi T
Biochemical pharmacology 2012 Nov 1;84(9):1196-206
Biochemical pharmacology 2012 Nov 1;84(9):1196-206
A novel polymorphic allele of human arylacetamide deacetylase leads to decreased enzyme activity.
Shimizu M, Fukami T, Kobayashi Y, Takamiya M, Aoki Y, Nakajima M, Yokoi T
Drug metabolism and disposition: the biological fate of chemicals 2012 Jun;40(6):1183-90
Drug metabolism and disposition: the biological fate of chemicals 2012 Jun;40(6):1183-90
Species differences in tissue distribution and enzyme activities of arylacetamide deacetylase in human, rat, and mouse.
Kobayashi Y, Fukami T, Nakajima A, Watanabe A, Nakajima M, Yokoi T
Drug metabolism and disposition: the biological fate of chemicals 2012 Apr;40(4):671-9
Drug metabolism and disposition: the biological fate of chemicals 2012 Apr;40(4):671-9
Human arylacetamide deacetylase is a principal enzyme in flutamide hydrolysis.
Watanabe A, Fukami T, Nakajima M, Takamiya M, Aoki Y, Yokoi T
Drug metabolism and disposition: the biological fate of chemicals 2009 Jul;37(7):1513-20
Drug metabolism and disposition: the biological fate of chemicals 2009 Jul;37(7):1513-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AADAC is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol