Antibody data

Product number
ABIN310653
Provider
antibodies-online
Product name
anti-Arylacetamide Deacetylase (Esterase) (AADAC) antibody
Provider product page
antibodies-online - ABIN310653
Antibody type
Polyclonal
Antigen
The immunogen for anti-AADAC antibody: synthetic peptide directed towards the C terminal of human AADAC
Reactivity
Human, Bovine, Canine, Rabbit
Host
Rabbit
Antigen sequence
NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLT
YVITC QYDLLRDDGL
Vial size
0.1 mg
Provider Type Product Number
- No reagents -