AV45038

AADAC antibody from Sigma-Aldrich
CES5A1, DAC
No application information provided.

Antibody data

Product number
AV45038
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV45038, RRID:AB_1844404
Product name
Anti-AADAC antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV45038
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human AADAC with an internal ID of P12326
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
ADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRN
TGVQVTHNHVEDGFH
Storage
-20C
Provider Type Product Number
- No reagents -