HPA002911

AADAC antibody from Sigma-Aldrich
CES5A1, DAC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002911, RRID:AB_1078074
Product name
Anti-AADAC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002911
Antibody type
Polyclonal
Antigen
Arylacetamide deacetylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYF
TTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPE
RFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLA
DDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNT
GV
Storage
-20C
Provider Type Product Number
- No reagents -