Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504614 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Factor Dp-1 (TFDP1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the middle region of human TFDP1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVG
EDDEE DDDFNENDED- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ARF directly binds DP1: interaction with DP1 coincides with the G1 arrest function of ARF.
Datta A, Sen J, Hagen J, Korgaonkar CK, Caffrey M, Quelle DE, Hughes DE, Ackerson TJ, Costa RH, Raychaudhuri P
Molecular and cellular biology 2005 Sep;25(18):8024-36
Molecular and cellular biology 2005 Sep;25(18):8024-36
No comments: Submit comment
No validations: Submit validation data