ABIN504665

TFDP1 antibody from antibodies-online
DILC, Dp-1, DP1, DRTF1

Antibody data

Product number
ABIN504665
Provider
antibodies-online
Product name
anti-Transcription Factor Dp-1 (TFDP1) antibody
Provider product page
antibodies-online - ABIN504665
Antibody type
Polyclonal
Antigen
The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the middle region of human TFDP1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYV
GEDDE EDDDFNENDE
Vial size
50 μg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Provider Type Product Number
- No reagents -