HPA002967

antibody from Atlas Antibodies

Targeting: IRAG2 JAW1, LRMP

Antibody data

Submit

Validation data

Product number: HPA002967 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002967, RRID:AB_1079161
Product name: Anti-LRMP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PSMEENGVERVCPESLLQSREYSSLPLPRHTSSTD GTITSSDPGLEILNMASCDLDRNSLCKKEEDTRSA SPTIEAQGTSPAHDNIAFQDSTSKDKTILNLEAKE EPETIEEHKKEHASGDSVVSPLPVTTVKSVNVRQS ENTSANEKEV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IRAG2 protein structure - HPA002967 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-LRMP antibody. Corresponding LRMP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, lymph node, skeletal muscle and tonsil using Anti-LRMP antibody HPA002967 (A) shows similar protein distribution across tissues to independent antibody HPA018505 (B).
Antibody #2 product nr: HPA018505
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-LRMP antibody HPA002967.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil using Anti-LRMP antibody HPA002967.
Sample type: HUMAN