HPA018322

TOX antibody from Sigma-Aldrich
KIAA0808, TOX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018322
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018322, RRID:AB_1858199
Product name
Anti-TOX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018322
Antibody type
Polyclonal
Antigen
Thymocyte selection-associated high mobility group box protein TOX recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQD
YVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVH
LNEVESGYHSLCHPMNHNGLLPFHPQN
Storage
-20C
Provider Type Product Number
- No reagents -