Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031166 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031166, RRID:AB_10601874
- Product name
- Anti-MLLT1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTK
PSHGSKDANKESSKTSKPHKVTKEHRERPRKDSES
KSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPP
PKAAFKEPKMALKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MLLT1 YEATS domain mutations in clinically distinctive Favourable Histology Wilms tumours.
Perlman EJ, Gadd S, Arold ST, Radhakrishnan A, Gerhard DS, Jennings L, Huff V, Guidry Auvil JM, Davidsen TM, Dome JS, Meerzaman D, Hsu CH, Nguyen C, Anderson J, Ma Y, Mungall AJ, Moore RA, Marra MA, Mullighan CG, Ma J, Wheeler DA, Hampton OA, Gastier-Foster JM, Ross N, Smith MA
Nature communications 2015 Dec 4;6:10013
Nature communications 2015 Dec 4;6:10013
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli fibrillar center.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.
- Sample type
- HUMAN