HPA031166

MLLT1 antibody from Sigma-Aldrich
ENL, LTG19, YEATS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031166
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031166, RRID:AB_10601874
Product name
Anti-MLLT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031166
Antibody type
Polyclonal
Antigen
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTK
PSHGSKDANKESSKTSKPHKVTKEHRERPRKDSES
KSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPP
PKAAFKEPKMALKE
Storage
-20C
Provider Type Product Number
- No reagents -