HPA002461

LAX1 antibody from Sigma-Aldrich
FLJ20340, LAX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002461, RRID:AB_1079239
Product name
Anti-LAX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002461
Antibody type
Polyclonal
Antigen
Lymphocyte transmembrane adapter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQ
LWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNI
GHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQ
SEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQ
GP
Storage
-20C
Provider Type Product Number
- No reagents -