HPA024748

CA8 antibody from Atlas Antibodies
CALS, CARP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024748
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024748, RRID:AB_1846003
Product name
Anti-CA8
Provider product page
Atlas Antibodies - HPA024748
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLT
IPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVK
GAELVEGCDGILGDNFRPTQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -