Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503219 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GABA(A) Receptor-Associated Protein (GABARAP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKA
PKARI GDLDKKKYLV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sustained structural change of GABA(A) receptor-associated protein underlies long-term potentiation at inhibitory synapses on a cerebellar Purkinje neuron.
Kawaguchi SY, Hirano T
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Jun 20;27(25):6788-99
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Jun 20;27(25):6788-99
No comments: Submit comment
No validations: Submit validation data