HPA009650

ANXA6 antibody from Atlas Antibodies
ANX6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009650
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009650, RRID:AB_1233459
Product name
Anti-ANXA6
Provider product page
Atlas Antibodies - HPA009650
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF
IKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKP
LFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLN
IRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGG
ED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -