Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009650 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009650, RRID:AB_1844867
- Product name
- Anti-ANXA6
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF
IKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKP
LFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLN
IRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGG
ED- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Comparative study of human and mouse postsynaptic proteomes finds high compositional conservation and abundance differences for key synaptic proteins.
Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin.
BayƩs A, Collins MO, Croning MD, van de Lagemaat LN, Choudhary JS, Grant SG
PloS one 2012;7(10):e46683
PloS one 2012;7(10):e46683
Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin.
Nakayama H, Fukuda S, Inoue H, Nishida-Fukuda H, Shirakata Y, Hashimoto K, Higashiyama S
Molecular biology of the cell 2012 May;23(10):1964-75
Molecular biology of the cell 2012 May;23(10):1964-75
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and A-431 using Anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human appendix and pancreas tissues using Anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human appendix shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong membranous positivity in islets of Langerhans.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
- Sample type
- HUMAN