HPA009650

ANXA6 antibody from Sigma-Aldrich
ANX6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009650
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009650, RRID:AB_1844867
Product name
Anti-ANXA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009650
Antibody type
Polyclonal
Antigen
Annexin A6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF
IKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKP
LFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLN
IRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGG
ED
Storage
-20C
Provider Type Product Number
- No reagents -