HPA022793

GTF2F1 antibody from Atlas Antibodies
BTF4, RAP74, TF2F1, TFIIF
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA022793
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022793, RRID:AB_1857946
Product name
Anti-GTF2F1
Provider product page
Atlas Antibodies - HPA022793
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYG
IVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTL
TAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -