HPA022793

GTF2F1 antibody from Sigma-Aldrich
BTF4, RAP74, TF2F1, TFIIF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022793
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022793, RRID:AB_1857946
Product name
Anti-GTF2F1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022793
Antibody type
Polyclonal
Antigen
General transcription factor IIF subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYG
IVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTL
TAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD
Storage
-20C
Provider Type Product Number
- No reagents -