HPA005972

BTG1 antibody from MilliporeSigma / Merck KGaA
APRO2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005972
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005972, RRID:AB_1078303
Product name
Anti-BTG1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005972
Antibody type
Polyclonal
Antigen
BTG1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQ
AAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGE
DGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEE
LLL
Storage
-20C
Provider Type Product Number
- No reagents -