HPA019611

CCIN antibody from Sigma-Aldrich
BTBD20, KBTBD14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019611
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019611, RRID:AB_1846174
Product name
Anti-CCIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019611
Antibody type
Polyclonal
Antigen
Calicin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLLSFQQDNILCVHSHRQSVEINLQKVKASKTTTS
VPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASD
VQTKDYTINPNAFLLDQKTGKWKTLAPPPEALDCP
ACCLAKLPCKILQRI
Storage
-20C
Provider Type Product Number
- No reagents -