HPA018459

KCTD17 antibody from Sigma-Aldrich
FLJ12242
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018459, RRID:AB_1852169
Product name
Anti-KCTD17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018459
Antibody type
Polyclonal
Antigen
BTB/POZ domain-containing protein KCTD17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRK
TKSTEEQLEEQQQQEEEVEEVEVEQVQVEADAQEK
AQS
Storage
-20C
Provider Type Product Number
- No reagents -