HPA012700

TNFSF14 antibody from Sigma-Aldrich
CD258, HVEM-L, LIGHT, LTg
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012700, RRID:AB_1852870
Product name
Anti-TNFSF14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012700
Antibody type
Polyclonal
Antigen
Tumor necrosis factor ligand superfamily member 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPA
AHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHD
GALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHG
LYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDS
SFLGGVV
Storage
-20C
Provider Type Product Number
- No reagents -