HPA012700

TNFSF14 antibody from Atlas Antibodies
CD258, HVEM-L, LIGHT, LTg
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012700
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012700, RRID:AB_1669215
Product name
Anti-TNFSF14
Provider product page
Atlas Antibodies - HPA012700
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPA
AHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHD
GALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHG
LYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDS
SFLGGVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -