HPA012700

TNFSF14 antibody from Atlas Antibodies
CD258, HVEM-L, LIGHT, LTg
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012700
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012700, RRID:AB_1852870
Product name
Anti-TNFSF14
Provider product page
Atlas Antibodies - HPA012700
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPA
AHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHD
GALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHG
LYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDS
SFLGGVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -