HPA002355

BTG2 antibody from Sigma-Aldrich
MGC126063, MGC126064, PC3, TIS21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002355
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002355, RRID:AB_1078304
Product name
Anti-BTG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002355
Antibody type
Polyclonal
Antigen
BTG2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPI
ISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYR
IGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Storage
-20C
Provider Type Product Number
- No reagents -