HPA020326

DUSP16 antibody from Sigma-Aldrich
KIAA1700, MKP-7, MKP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020326
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020326, RRID:AB_1847890
Product name
Anti-DUSP16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020326
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSETPLSPPCADSATSEAAGQRPVHPASVPSVPSV
QPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFS
LDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTL
DGTNKLCQFSPVQELSEQTPETSPDKEEASIPKK
Storage
-20C
Provider Type Product Number
- No reagents -