HPA024743

ZNF695 antibody from Sigma-Aldrich
SBZF3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024743
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024743, RRID:AB_1859419
Product name
Anti-ZNF695 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024743
Antibody type
Polyclonal
Antigen
Zinc finger protein 695 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GENPYQCKKCGKAFNECSCFTDCKRIHVGEKHCKC
EECNNIFKSCSSLAVVEKNHTEKKTYRCEE
Storage
-20C
Provider Type Product Number
- No reagents -