HPA002568

PPP4R3A antibody from Atlas Antibodies
FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002568
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002568, RRID:AB_1079207
Product name
Anti-PPP4R3A
Provider product page
Atlas Antibodies - HPA002568
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESE
EKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSS
TTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITT
KGGLVGLVDYPDDDEDDDEDEDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -