HPA002568

PPP4R3A antibody from Sigma-Aldrich
FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002568
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002568, RRID:AB_1079207
Product name
Anti-SMEK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002568
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase 4 regulatory subunit 3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESE
EKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSS
TTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITT
KGGLVGLVDYPDDDEDDDEDEDK
Storage
-20C
Provider Type Product Number
- No reagents -