HPA003224

VAV2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003224
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003224, RRID:AB_1080554
Product name
Anti-VAV2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003224
Antibody type
Polyclonal
Antigen
Guanine nucleotide exchange factor VAV2
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGY
FPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAG
NMERQQTDNLLKSHASGTYLIRERPAEAERFAISI
KFNDEVKHIKVVEKDNWI
Storage
-20C
Provider Type Product Number
- No reagents -